Crystal structure of salmonella typhimurium tryptophan synthase mutant beta-q114a with 2-({[4-(trifluoromethoxy)phenyl]sulfonyl}amino)ethyl dihydrogen phosphate (f9f) at the alpha-site, cesium ion at the metal coordination site, and (e)-n-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-l-serine at the beta-site
PDB DOI: 10.2210/pdb6dzo/pdb
Classification: LYASE/LYASE Inhibitor Organism(s): Salmonella Typhimurium (Strain Lt2 / Sgsc1412 / Atcc 700720)
Deposited: 2018-07-05 Deposition Author(s): Dunn, M.F. , Fan, L. , Hilario, E. , Mueller, L.J.
Crystal structure of salmonella typhimurium tryptophan synthase mutant beta-q114a with 2-({[4-(trifluoromethoxy)phenyl]sulfonyl}amino)ethyl dihydrogen phosphate (f9f) at the alpha-site, cesium ion at the metal coordination site, and (e)-n-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-l-serine at the beta-site
Dunn, M.F. , Fan, L. , Hilario, E. , Mueller, L.J.
Primary Citation of Related Structures: 6DZO
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Tryptophan synthase alpha chain | A | 268 | Salmonella Typhimurium (Strain Lt2 / Sgsc1412 / Atcc 700720) | MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRGALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA |
| Tryptophan synthase beta chain | B | 394 | Salmonella Typhimurium (Strain Lt2 / Sgsc1412 / Atcc 700720) | TTLLNPYFGEFGGMYVPQILMPALNQLEEAFVSAQKDPEFQAQFADLLKNYAGRPTALTKCQNITAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGAGAHGVASALASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGSYETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILDKEGRLPDAVIACVGGGSNAIGMFADFINDTSVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTADGQIEESYSISAGLDFPSVGPQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPALESSHALAHALKMMREQPEKEQLLVVNLSGRGDKDIFTVHDILKARG |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-07-05 Deposition Author(s): Dunn, M.F. , Fan, L. , Hilario, E. , Mueller, L.J.