Crystal structure of p300 zz domain in complex with histone h3 peptide
PDB DOI: 10.2210/pdb6ds6/pdb
Classification: GENE REGULATION, Transferase Organism(s): Homo Sapiens
Deposited: 2018-06-13 Deposition Author(s): Kutateladze, T.G. , Zhang, Y.
Method: X-RAY DIFFRACTION Resolution: 1.95 Å
Crystal structure of p300 zz domain in complex with histone h3 peptide
Primary Citation of Related Structures: 6DS6
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Histone H3 peptide-Histone acetyltransferase p300 Chimeric protein | A | 57 | Homo Sapiens | ARTKQTQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLD |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-06-13 Deposition Author(s): Kutateladze, T.G. , Zhang, Y.