Crystal structure of p300 zz domain in complex with histone h3 peptide
PDB DOI: 10.2210/pdb6ds6/pdb
Classification: GENE REGULATION, Transferase Organism(s): Homo Sapiens
Deposited: 2018-06-13 Deposition Author(s): Kutateladze, T.G. , Zhang, Y.
Crystal structure of p300 zz domain in complex with histone h3 peptide
Primary Citation of Related Structures: 6DS6
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Histone H3 peptide-Histone acetyltransferase p300 Chimeric protein | A | 57 | Homo Sapiens | ARTKQTQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLD |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-06-13 Deposition Author(s): Kutateladze, T.G. , Zhang, Y.