Crystal structure of bacillus halodurans ribonuclease h1 in complex with an rna/dna hybrid: soak in 0.5 mm egta and 200 mm k+ at 21 c
PDB DOI: 10.2210/pdb6doh/pdb
Classification: HYDROLASE/RNA/DNA Organism(s): Bacillus Halodurans (Strain Atcc Baa-125 / Dsm 18197 / Ferm 7344 / Jcm 9153 / C-125) , Synthetic Construct
Deposited: 2018-06-09 Deposition Author(s): Samara, N.L. , Yang, W.
Crystal structure of bacillus halodurans ribonuclease h1 in complex with an rna/dna hybrid: soak in 0.5 mm egta and 200 mm k+ at 21 c
Primary Citation of Related Structures: 6DOH
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ribonuclease H | A | 133 | Bacillus Halodurans (Strain Atcc Baa-125 / Dsm 18197 / Ferm 7344 / Jcm 9153 / C-125) , Synthetic Construct | EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSDSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADY |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-06-09 Deposition Author(s): Samara, N.L. , Yang, W.