Crystal structure of bacillus halodurans ribonuclease h1 in complex with an rna/dna hybrid: reaction in 2 mm mg2+ and 200 mm k+ for 480 s at 21 c
PDB DOI: 10.2210/pdb6doa/pdb
Classification: hydrolase/dna/rna Organism(s): Bacillus Halodurans , Synthetic Construct
Deposited: 2018-06-09 Deposition Author(s): Samara, N.L. , Yang, W.
Crystal structure of bacillus halodurans ribonuclease h1 in complex with an rna/dna hybrid: reaction in 2 mm mg2+ and 200 mm k+ for 480 s at 21 c
Primary Citation of Related Structures: 6DOA
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ribonuclease H | A | 136 | Bacillus Halodurans , Synthetic Construct | EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSDSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGRK |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-06-09 Deposition Author(s): Samara, N.L. , Yang, W.