Crystal structure of bacillus halodurans ribonuclease h1 in complex with an rna/dna hybrid: reaction in 2 mm mg2+ and 200 mm k+ for 120 s at 21 c
PDB DOI: 10.2210/pdb6do9/pdb
Classification: hydrolase/dna/rna Organism(s): Methanosarcinales Archaeon , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2018-06-09 Deposition Author(s): Samara, N.L. , Yang, W.
Crystal structure of bacillus halodurans ribonuclease h1 in complex with an rna/dna hybrid: reaction in 2 mm mg2+ and 200 mm k+ for 120 s at 21 c
Primary Citation of Related Structures: 6DO9
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Ribonuclease H | A | 136 | Methanosarcinales Archaeon , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSDSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGRK |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-06-09 Deposition Author(s): Samara, N.L. , Yang, W.