N-domain of grp94, with the charged domain, in complex with the novel ligand n-propyl carboxyamido adenosine
PDB DOI: 10.2210/pdb6d1x/pdb
Classification: CHAPERONE Organism(s): Canis Lupus Familiaris
Deposited: 2018-04-12 Deposition Author(s): Gewirth, D.T. , Immormino, R.M.
N-domain of grp94, with the charged domain, in complex with the novel ligand n-propyl carboxyamido adenosine
Gewirth, D.T. , Immormino, R.M.
Primary Citation of Related Structures: 6D1X
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Endoplasmin | A | 273 | Canis Lupus Familiaris | GSHMLREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTETVEEPMEEEEAAKEEKEDSDDEAAVEEEEEEKKPKTKKVEKTVWDWELMN |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-04-12 Deposition Author(s): Gewirth, D.T. , Immormino, R.M.