Crystal structure of the complex between human chromobox homolog 1 (cbx1) and h3k9me3 peptide
PDB DOI: 10.2210/pdb6d07/pdb
Classification: PROTEIN BINDING Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2018-04-10 Deposition Author(s): Arora, S. , Horne, W.S. , Islam, K.
Crystal structure of the complex between human chromobox homolog 1 (cbx1) and h3k9me3 peptide
Arora, S. , Horne, W.S. , Islam, K.
Primary Citation of Related Structures: 6D07
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Chromobox protein homolog 1 | A | 55 | Homo Sapiens , Synthetic Construct | GEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKT |
Chromobox protein homolog 1 | B | 55 | Homo Sapiens , Synthetic Construct | GEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKT |
Histone H3.1 | C | 16 | Homo Sapiens , Synthetic Construct | ARTKQTARKSTGGKAX |
Histone H3.1 | D | 16 | Homo Sapiens , Synthetic Construct | ARTKQTARKSTGGKAX |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-04-10 Deposition Author(s): Arora, S. , Horne, W.S. , Islam, K.