Crystal structure of lambda-cro bound to a consensus operator at 3.0 angstrom resolution
PDB DOI: 10.2210/pdb6cro/pdb
Classification: GENE REGULATION/DNA Organism(s): Treponema Pallidum , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 1998-04-22 Deposition Author(s): Albright, R.A. , Matthews, B.W.
Crystal structure of lambda-cro bound to a consensus operator at 3.0 angstrom resolution
Albright, R.A. , Matthews, B.W.
Primary Citation of Related Structures: 6CRO
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
LAMBDA CRO REPRESSOR | A | 60 | Treponema Pallidum , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | EQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKPFPSN |
Method: X-RAY DIFFRACTION
Deposited Date: 1998-04-22 Deposition Author(s): Albright, R.A. , Matthews, B.W.