The sh3 domain of mlk3 in complex with poly-proline peptide derived from htt
PDB DOI: 10.2210/pdb6cq7/pdb
Classification: TRANSFERASE Organism(s): Homo Sapiens
Deposited: 2018-03-14 Deposition Author(s): Kall, S.L. , Lavie, A.
The sh3 domain of mlk3 in complex with poly-proline peptide derived from htt
Primary Citation of Related Structures: 6CQ7
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Mitogen-activated protein kinase kinase kinase 11, Huntingtin fusion protein | A | 80 | Homo Sapiens | GSHMYANPVWTALFDYEPSGQDELALRKGDRVEVLSRDAAISGDEGWWAGQVGGQVGIFPSNYVSRGGGPPPPGPAVAEE |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-03-14 Deposition Author(s): Kall, S.L. , Lavie, A.