6CNP
Crystal structure of mbd2 complex with methylated cpg island
PDB DOI: 10.2210/pdb6cnp/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2018-03-08 Deposition Author(s): Min, J. , Structural Genomics Consortium (Sgc) , Xu, C.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.1 Å
Crystal structure of mbd2 complex with methylated cpg island
Min, J. , Structural Genomics Consortium (Sgc) , Xu, C.
Primary Citation of Related Structures: 6CNP
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Methyl-CpG-binding domain protein 2 | A | 96 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MHHHHHHSSGRENLYFQGATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTVDLSSFDFRTGKMMPSKLQK |
| Methyl-CpG-binding domain protein 2 | B | 96 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MHHHHHHSSGRENLYFQGATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTVDLSSFDFRTGKMMPSKLQK |
| Nucleic Acids / Hybrid | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| DNA (5'-D(*GP*CP*CP*AP*CP*(5CM)P*GP*GP*TP*GP*GP*C)-3') | c | 12 | NA | GCCACCGGTGGC |
| DNA (5'-D(*GP*CP*CP*AP*CP*(5CM)P*GP*GP*TP*GP*GP*C)-3') | d | 12 | NA | GCCACCGGTGGC |
| DNA (5'-D(*GP*CP*CP*AP*CP*(5CM)P*GP*GP*TP*GP*GP*C)-3') | e | 12 | NA | GCCACCGGTGGC |
| DNA (5'-D(*GP*CP*CP*AP*CP*(5CM)P*GP*GP*TP*GP*GP*C)-3') | f | 12 | NA | GCCACCGGTGGC |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2018-03-08 Deposition Author(s): Min, J. , Structural Genomics Consortium (Sgc) , Xu, C.