Crystal structure of fragment 3-(3-methyl-4-oxo-3,4-dihydroquinazolin-2-yl)propanoic acid bound in the ubiquitin binding pocket of the hdac6 zinc-finger domain
PDB DOI: 10.2210/pdb6ced/pdb
Classification: HYDROLASE Organism(s): Homo Sapiens
Deposited: 2018-02-11 Deposition Author(s): Arrowsmith, C.M. , Bountra, C. , Edwards, A.M. , Ferreira De Freitas, R. , Franzoni, I. , Halabelian, L. , Harding, R.J. , Lautens, M. , Ravichandran, M. , Santhakumar, V. , Schapira, M. , Structural Genomics Consortium (Sgc)
Crystal structure of fragment 3-(3-methyl-4-oxo-3,4-dihydroquinazolin-2-yl)propanoic acid bound in the ubiquitin binding pocket of the hdac6 zinc-finger domain
Arrowsmith, C.M. , Bountra, C. , Edwards, A.M. , Ferreira De Freitas, R. , Franzoni, I. , Halabelian, L. , Harding, R.J. , Lautens, M. , Ravichandran, M. , Santhakumar, V. , Schapira, M. , Structural Genomics Consortium (Sgc)
Primary Citation of Related Structures: 6CED
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Histone deacetylase 6 | A | 107 | Homo Sapiens | GSPLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKFGEDMPH |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-02-11 Deposition Author(s): Arrowsmith, C.M. , Bountra, C. , Edwards, A.M. , Ferreira De Freitas, R. , Franzoni, I. , Halabelian, L. , Harding, R.J. , Lautens, M. , Ravichandran, M. , Santhakumar, V. , Schapira, M. , Structural Genomics Consortium (Sgc)