Mbd2 in complex with a partially methylated dna
PDB DOI: 10.2210/pdb6c1t/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2018-01-05 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Lei, M. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W.
Mbd2 in complex with a partially methylated dna
Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Lei, M. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W.
Primary Citation of Related Structures: 6C1T
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Methyl-CpG-binding domain protein 2 | A | 79 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTVDLSSFDFRTGKMMPSKLQK |
Methyl-CpG-binding domain protein 2 | D | 79 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTVDLSSFDFRTGKMMPSKLQK |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-01-05 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Lei, M. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W.