Actinin-1 ef-hand bound to the cav1.2 iq motif
PDB DOI: 10.2210/pdb6c0a/pdb
Classification: SIGNALING PROTEIN Organism(s): Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2017-12-28 Deposition Author(s): Ames, J.B. , Turner, M.L.
Actinin-1 ef-hand bound to the cav1.2 iq motif
Primary Citation of Related Structures: 6C0A
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Alpha-actinin-1 | A | 71 | Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | DTDTADQVMASFKILAGDKNYITMDELRRELPPDQAEYCIARMAPYTGPDSVPGALDYMSFSTALYGESDL |
Voltage-dependent L-type calcium channel subunit alpha-1C | B | 23 | Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GKFYATFLIQEYFRKFKKRKEQG |
Method: SOLUTION NMR
Deposited Date: 2017-12-28 Deposition Author(s): Ames, J.B. , Turner, M.L.