Rpt1 region of ini1/snf5/smarcb1_human - swi/snf-related matrix-associated actin-dependent regulator of chromatin subfamily b member 1.
PDB DOI: 10.2210/pdb6ax5/pdb
Classification: NUCLEAR PROTEIN Organism(s): Homo Sapiens
Deposited: 2017-09-06 Deposition Author(s): Almo, S.C. , Bernowitz, M. , Cahill, S.M. , Cowburn, D. , Girvin, M.E. , Harris, R. , Kalpana, G.V. , Prakash, R. , Spira, M. , Wu, X.
Rpt1 region of ini1/snf5/smarcb1_human - swi/snf-related matrix-associated actin-dependent regulator of chromatin subfamily b member 1.
Almo, S.C. , Bernowitz, M. , Cahill, S.M. , Cowburn, D. , Girvin, M.E. , Harris, R. , Kalpana, G.V. , Prakash, R. , Spira, M. , Wu, X.
Primary Citation of Related Structures: 6AX5
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 | A | 83 | Homo Sapiens | PEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIK |
Method: SOLUTION NMR
Deposited Date: 2017-09-06 Deposition Author(s): Almo, S.C. , Bernowitz, M. , Cahill, S.M. , Cowburn, D. , Girvin, M.E. , Harris, R. , Kalpana, G.V. , Prakash, R. , Spira, M. , Wu, X.