PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

6AX5

Rpt1 region of ini1/snf5/smarcb1_human - swi/snf-related matrix-associated actin-dependent regulator of chromatin subfamily b member 1.

PDB DOI: 10.2210/pdb6ax5/pdb

Classification: NUCLEAR PROTEIN
Organism(s): Homo Sapiens

Deposited: 2017-09-06
Deposition Author(s): Almo, S.C. , Bernowitz, M. , Cahill, S.M. , Cowburn, D. , Girvin, M.E. , Harris, R. , Kalpana, G.V. , Prakash, R. , Spira, M. , Wu, X.

Experimental Data Snapshot

Method: SOLUTION NMR
Resolution: N.A.

Literature

Rpt1 region of ini1/snf5/smarcb1_human - swi/snf-related matrix-associated actin-dependent regulator of chromatin subfamily b member 1.

Almo, S.C. , Bernowitz, M. , Cahill, S.M. , Cowburn, D. , Girvin, M.E. , Harris, R. , Kalpana, G.V. , Prakash, R. , Spira, M. , Wu, X.

Primary Citation of Related Structures: 6AX5


Proteins
Molecule Chains Sequence Length Organism Sequence
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 A 83 Homo Sapiens PEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIK
Experimental Data

Method: SOLUTION NMR

Deposited Date: 2017-09-06
Deposition Author(s): Almo, S.C. , Bernowitz, M. , Cahill, S.M. , Cowburn, D. , Girvin, M.E. , Harris, R. , Kalpana, G.V. , Prakash, R. , Spira, M. , Wu, X.