6AT0
Chromodomain hp1 with a p-nitro-l-phenylalanine mutation at position 24 bound to histone h3 peptide containing trimethyl lysine
PDB DOI: 10.2210/pdb6at0/pdb
Classification: TRANSCRIPTION Organism(s): Drosophila Melanogaster , Synthetic Construct
Deposited: 2017-08-27 Deposition Author(s): Baril, S.A. , Brustad, E.M. , Waters, M.L.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.285 Å
Chromodomain hp1 with a p-nitro-l-phenylalanine mutation at position 24 bound to histone h3 peptide containing trimethyl lysine
Baril, S.A. , Brustad, E.M. , Waters, M.L.
Primary Citation of Related Structures: 6AT0
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Heterochromatin protein 1 | A | 69 | Drosophila Melanogaster , Synthetic Construct | MKKHHHHHHAEEEEEEFAVEKIIDRRVRKGMVEYYLKWKGYPETENTWEPENNLDCQDLIQQYEASRKD |
| trimethyl lysine histone H3 tail peptide | P | 6 | Drosophila Melanogaster , Synthetic Construct | QTARKS |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2017-08-27 Deposition Author(s): Baril, S.A. , Brustad, E.M. , Waters, M.L.