Chromodomain hp1 with y24f mutation bound to histone h3 peptide containing trimethyl lysine
PDB DOI: 10.2210/pdb6asz/pdb
Classification: TRANSCRIPTION Organism(s): Murine Hepatitis Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2017-08-27 Deposition Author(s): Baril, S.A. , Brustad, E.M. , Waters, M.L.
Chromodomain hp1 with y24f mutation bound to histone h3 peptide containing trimethyl lysine
Baril, S.A. , Brustad, E.M. , Waters, M.L.
Primary Citation of Related Structures: 6ASZ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Heterochromatin protein 1 | A | 69 | Murine Hepatitis Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MKKHHHHHHAEEEEEEFAVEKIIDRRVRKGMVEYYLKWKGYPETENTWEPENNLDCQDLIQQYEASRKD |
trimethyl lysine histone H3 tail peptide | P | 6 | Murine Hepatitis Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | QTARKS |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-08-27 Deposition Author(s): Baril, S.A. , Brustad, E.M. , Waters, M.L.