The nmr structure of the polysialyltranseferase domain (pstd) in polysialyltransferase st8siaiv
PDB DOI: 10.2210/pdb6ahz/pdb
Classification: SUGAR BINDING PROTEIN Organism(s): N.A.
Deposited: 2018-08-21 Deposition Author(s): Chen, D. , Huang, R.B. , Liao, S.M. , Liu, X.H. , Lu, B. , Lu, Z.L. , Peng, L.X. , Zhou, F. , Zhou, G.P.
The nmr structure of the polysialyltranseferase domain (pstd) in polysialyltransferase st8siaiv
Chen, D. , Huang, R.B. , Liao, S.M. , Liu, X.H. , Lu, B. , Lu, Z.L. , Peng, L.X. , Zhou, F. , Zhou, G.P.
Primary Citation of Related Structures: 6AHZ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase | A | 35 | N.A. | LKNKLKVRTAYPSLRLIHAVRGYWLTNKVPIKRPS |
Method: SOLUTION NMR
Deposited Date: 2018-08-21 Deposition Author(s): Chen, D. , Huang, R.B. , Liao, S.M. , Liu, X.H. , Lu, B. , Lu, Z.L. , Peng, L.X. , Zhou, F. , Zhou, G.P.