Architectural roles of cren7 in folding crenarchaeal chromatin filament
PDB DOI: 10.2210/pdb6a2i/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Sulfolobus Solfataricus (Strain Atcc 35092 / Dsm 1617 / Jcm 11322 / P2) , Synthetic Construct
Deposited: 2018-06-11 Deposition Author(s): Chen, Y.Y. , Dong, Y.H. , Gong, Y. , Huang, L. , Wang, L. , Zhang, Z.F. , Zhao, M.H.
Architectural roles of cren7 in folding crenarchaeal chromatin filament
Chen, Y.Y. , Dong, Y.H. , Gong, Y. , Huang, L. , Wang, L. , Zhang, Z.F. , Zhao, M.H.
Primary Citation of Related Structures: 6A2I
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Chromatin protein Cren7 | A | 60 | Sulfolobus Solfataricus (Strain Atcc 35092 / Dsm 1617 / Jcm 11322 / P2) , Synthetic Construct | MSSGKKPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI |
| Chromatin protein Cren7 | B | 60 | Sulfolobus Solfataricus (Strain Atcc 35092 / Dsm 1617 / Jcm 11322 / P2) , Synthetic Construct | MSSGKKPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-06-11 Deposition Author(s): Chen, Y.Y. , Dong, Y.H. , Gong, Y. , Huang, L. , Wang, L. , Zhang, Z.F. , Zhao, M.H.