Structure of nephrin/magi1 complex
PDB DOI: 10.2210/pdb5zys/pdb
Classification: CELL ADHESION Organism(s): Mus Musculus , Synthetic Construct
Deposited: 2018-05-28 Deposition Author(s): Shng, Y. , Weng, Z.F. , Zhang, R.G. , Zhu, J.W.
Method: X-RAY DIFFRACTION Resolution: 1.78 Å
Structure of nephrin/magi1 complex
Shng, Y. , Weng, Z.F. , Zhang, R.G. , Zhu, J.W.
Primary Citation of Related Structures: 5ZYS
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 | A | 97 | Mus Musculus , Synthetic Construct | GPGSIPDYQEQDIFLWRKETGFGFRILGGNEPGEPIYIGHIVPLGAADTDGRLRSGDELICVDGTPVIGKSHQLVVQLMQQAAKQGHVNLTVRRKVV |
| Nephrin | B | 10 | Mus Musculus , Synthetic Construct | LPFELRGHLV |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-05-28 Deposition Author(s): Shng, Y. , Weng, Z.F. , Zhang, R.G. , Zhu, J.W.