Crystal structure of the human coronavirus sars hr1 motif in complex with pan-covs inhibitor ek1
PDB DOI: 10.2210/pdb5zvm/pdb
Classification: VIRAL PROTEIN/INHIBITOR Organism(s): Human Sars Coronavirus , Synthetic Construct
Deposited: 2018-05-11 Deposition Author(s): Wilson, I.A. , Yan, L. , Yang, B.
Method: X-RAY DIFFRACTION Resolution: 3.3 Å
Crystal structure of the human coronavirus sars hr1 motif in complex with pan-covs inhibitor ek1
Wilson, I.A. , Yan, L. , Yang, B.
Primary Citation of Related Structures: 5ZVM
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
pan-CoV inhibitory peptide EK1 | A | 44 | Human Sars Coronavirus , Synthetic Construct | SGGRGGSLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGG |
pan-CoV inhibitory peptide EK1 | B | 44 | Human Sars Coronavirus , Synthetic Construct | SGGRGGSLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGG |
pan-CoV inhibitory peptide EK1 | C | 44 | Human Sars Coronavirus , Synthetic Construct | SGGRGGSLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGG |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-05-11 Deposition Author(s): Wilson, I.A. , Yan, L. , Yang, B.