Crystal structure of the human coronavirus sars hr1 motif in complex with pan-covs inhibitor ek1
PDB DOI: 10.2210/pdb5zvm/pdb
Classification: VIRAL PROTEIN/INHIBITOR Organism(s): Canavalia Gladiata , Fremyella Diplosiphon
Deposited: 2018-05-11 Deposition Author(s): Wilson, I.A. , Yan, L. , Yang, B.
Crystal structure of the human coronavirus sars hr1 motif in complex with pan-covs inhibitor ek1
Wilson, I.A. , Yan, L. , Yang, B.
Primary Citation of Related Structures: 5ZVM
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
pan-CoV inhibitory peptide EK1 | A | 44 | Canavalia Gladiata , Fremyella Diplosiphon | SGGRGGSLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGG |
pan-CoV inhibitory peptide EK1 | B | 44 | Canavalia Gladiata , Fremyella Diplosiphon | SGGRGGSLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGG |
pan-CoV inhibitory peptide EK1 | C | 44 | Canavalia Gladiata , Fremyella Diplosiphon | SGGRGGSLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGG |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-05-11 Deposition Author(s): Wilson, I.A. , Yan, L. , Yang, B.