Solution structure of peptide cq2 from chenopodium quinoa
PDB DOI: 10.2210/pdb5zv6/pdb
Classification: PLANT PROTEIN Organism(s): Chenopodium Quinoa
Deposited: 2018-05-09 Deposition Author(s): Jiayi, H. , Jingsong, F. , Ka H, W. , Stephanie, T.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of peptide cq2 from chenopodium quinoa
Jiayi, H. , Jingsong, F. , Ka H, W. , Stephanie, T.
Primary Citation of Related Structures: 5ZV6
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| cQ2 | A | 30 | Chenopodium Quinoa | AGECVRGRCPGGLCCSKFGFCGSGPAYCGG |
Method: SOLUTION NMR
Deposited Date: 2018-05-09 Deposition Author(s): Jiayi, H. , Jingsong, F. , Ka H, W. , Stephanie, T.