Solution structure of the dna complex of the c-terminal domain of rok
PDB DOI: 10.2210/pdb5zux/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Ligusticum Chuanxiong , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2018-05-08 Deposition Author(s): Duan, B. , Xia, B.
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Rok | A | 92 | Ligusticum Chuanxiong , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GTTRRRRGTARPGSKAAKLREAAIKTLKRHNAAIKSSELQKEIEKESGLEIPNMTTFMQSLIKMYPEVKKPYRGQYILEGEIESLEHHHHHH |
Method: SOLUTION NMR