Crystal structure of a beta gamma-crystallin domain of abundant perithecial protein (app) from neurospora crassa in the ca2+-bound form
PDB DOI: 10.2210/pdb5z6e/pdb
Classification: METAL BINDING PROTEIN Organism(s): Neurospora Crassa (Strain Atcc 24698 / 74-Or23-1A / Cbs 708.71 / Dsm 1257 / Fgsc 987)
Deposited: 2018-01-22 Deposition Author(s): Sankaranarayanan, R. , Srivastava, S.S.
Crystal structure of a beta gamma-crystallin domain of abundant perithecial protein (app) from neurospora crassa in the ca2+-bound form
Sankaranarayanan, R. , Srivastava, S.S.
Primary Citation of Related Structures: 5Z6E
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| DUF1881 domain-containing protein | A | 101 | Neurospora Crassa (Strain Atcc 24698 / 74-Or23-1A / Cbs 708.71 / Dsm 1257 / Fgsc 987) | MAPSVDPTKVIFYQKKNFEGSGDTYAVGQDVSVPGSLNDKYFSVAVGASAKVIAWQHYNETGHYREWTTSQADISDIGGLSRFRVVDDDTRAISFLFKDAT |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-01-22 Deposition Author(s): Sankaranarayanan, R. , Srivastava, S.S.