Crystal structure analysis of cin85-sh3b in complex with arap1-p2
PDB DOI: 10.2210/pdb5xhz/pdb
Classification: PROTEIN BINDING Organism(s): Mus Musculus , Synthetic Construct
Deposited: 2017-04-25 Deposition Author(s): Liu, W. , Yang, W.
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
SH3 domain-containing kinase-binding protein 1 | A | 66 | Mus Musculus , Synthetic Construct | GPGSEFRRRRRCQVAFSYLPQNDDELELKVGDIIEVVGEVEEGWWEGVLNGKTGMFPSNFIKELSG |
SH3 domain-containing kinase-binding protein 1 | B | 66 | Mus Musculus , Synthetic Construct | GPGSEFRRRRRCQVAFSYLPQNDDELELKVGDIIEVVGEVEEGWWEGVLNGKTGMFPSNFIKELSG |
Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 | C | 11 | Mus Musculus , Synthetic Construct | RPVPMKRHIFR |
Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 | D | 11 | Mus Musculus , Synthetic Construct | RPVPMKRHIFR |
Method: X-RAY DIFFRACTION