PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

5XHZ

Crystal structure analysis of cin85-sh3b in complex with arap1-p2

PDB DOI: 10.2210/pdb5xhz/pdb

Classification: PROTEIN BINDING
Organism(s): Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)

Deposited: 2017-04-25
Deposition Author(s): Liu, W. , Yang, W.

Experimental Data Snapshot

Method: X-RAY DIFFRACTION
Resolution: 1.319 Å

Literature

Crystal structure analysis of cin85-sh3b in complex with arap1-p2

Liu, W. , Yang, W.

Primary Citation of Related Structures: 5XHZ


Proteins
Molecule Chains Sequence Length Organism Sequence
SH3 domain-containing kinase-binding protein 1 A 66 Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) GPGSEFRRRRRCQVAFSYLPQNDDELELKVGDIIEVVGEVEEGWWEGVLNGKTGMFPSNFIKELSG
SH3 domain-containing kinase-binding protein 1 B 66 Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) GPGSEFRRRRRCQVAFSYLPQNDDELELKVGDIIEVVGEVEEGWWEGVLNGKTGMFPSNFIKELSG
Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 C 11 Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) RPVPMKRHIFR
Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 D 11 Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) RPVPMKRHIFR
Experimental Data

Method: X-RAY DIFFRACTION

Deposited Date: 2017-04-25
Deposition Author(s): Liu, W. , Yang, W.