The crystal structure of cren7 mutant l28a in complex with dsdna
PDB DOI: 10.2210/pdb5wvw/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Talaromyces Cellulolyticus Cf-2612 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2016-12-29 Deposition Author(s): Chen, Y.Y. , Dong, Y.H. , Gong, Y. , Huang, L. , Wang, L. , Zhang, Z.F. , Zhao, M.H.
The crystal structure of cren7 mutant l28a in complex with dsdna
Chen, Y.Y. , Dong, Y.H. , Gong, Y. , Huang, L. , Wang, L. , Zhang, Z.F. , Zhao, M.H.
Primary Citation of Related Structures: 5WVW
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Chromatin protein Cren7 | A | 60 | Talaromyces Cellulolyticus Cf-2612 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MSSGKKPVKVKTPAGKEAELVPEKVWAAAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI |
Chromatin protein Cren7 | B | 60 | Talaromyces Cellulolyticus Cf-2612 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MSSGKKPVKVKTPAGKEAELVPEKVWAAAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-12-29 Deposition Author(s): Chen, Y.Y. , Dong, Y.H. , Gong, Y. , Huang, L. , Wang, L. , Zhang, Z.F. , Zhao, M.H.