Solution structure of the pseudo-receiver domain of atg32
PDB DOI: 10.2210/pdb5wlp/pdb
Classification: PROTEIN TRANSPORT Organism(s): Saccharomyces Cerevisiae
Deposited: 2017-07-27 Deposition Author(s): Pellegrini, M. , Ragusa, M.J. , Xue, X.
Solution structure of the pseudo-receiver domain of atg32
Pellegrini, M. , Ragusa, M.J. , Xue, X.
Primary Citation of Related Structures: 5WLP
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Autophagy-related protein 32 | A | 145 | Saccharomyces Cerevisiae | SNATNSFVMPKLSLTQKNPVFRLLILGRTGSSFYQSIPKEYQSLFELPKYHDSATFPQYTGIVIIFQELREMVSLLNRIVQYSQGKPVIPICQPGQVIQVKNVLKSFLRNKLVKLLFPPVVVTNKRDLKKMFQRLQDLSLEYGED |
Method: SOLUTION NMR
Deposited Date: 2017-07-27 Deposition Author(s): Pellegrini, M. , Ragusa, M.J. , Xue, X.