5W9Q
Zinc finger region of mbd1 in complex with cpg dna
PDB DOI: 10.2210/pdb5w9q/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2017-06-23 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Liu, K. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W. , Walker, J.R. , Xu, C.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.8 Å
Zinc finger region of mbd1 in complex with cpg dna
Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Liu, K. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W. , Walker, J.R. , Xu, C.
Primary Citation of Related Structures: 5W9Q
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Methyl-CpG-binding domain protein 1 | A | 60 | Homo Sapiens , Synthetic Construct | GTNRRQNRKCGACAACLRRMDCGRCDFCCDKPKFGGSNQKRQKCRWRQCLQFAMKRLLPS |
| Methyl-CpG-binding domain protein 1 | B | 60 | Homo Sapiens , Synthetic Construct | GTNRRQNRKCGACAACLRRMDCGRCDFCCDKPKFGGSNQKRQKCRWRQCLQFAMKRLLPS |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2017-06-23 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Liu, K. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W. , Walker, J.R. , Xu, C.