Mcl-1 in complex with bim-h3pc-rt
PDB DOI: 10.2210/pdb5vx2/pdb
Classification: APOPTOSIS Organism(s): Homo Sapiens , Mus Musculus , Synthetic Construct
Deposited: 2017-05-23 Deposition Author(s): Brouwer, J.M. , Colman, P.M. , Cowan, A.D. , Czabotar, P.E.
Mcl-1 in complex with bim-h3pc-rt
Brouwer, J.M. , Colman, P.M. , Cowan, A.D. , Czabotar, P.E.
Primary Citation of Related Structures: 5VX2
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Induced myeloid leukemia cell differentiation protein Mcl-1 homolog,Induced myeloid leukemia cell differentiation protein Mcl-1 chimera | A | 162 | Homo Sapiens , Mus Musculus , Synthetic Construct | GPLGSEDDLYRQSLEIISRYLREQATGSKDSKPLGEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGG |
Induced myeloid leukemia cell differentiation protein Mcl-1 homolog,Induced myeloid leukemia cell differentiation protein Mcl-1 chimera | C | 162 | Homo Sapiens , Mus Musculus , Synthetic Construct | GPLGSEDDLYRQSLEIISRYLREQATGSKDSKPLGEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGG |
Bcl-2-like protein 11 | B | 26 | Homo Sapiens , Mus Musculus , Synthetic Construct | DMRPEIRIAQELRRXGDEFNATYARR |
Bcl-2-like protein 11 | D | 26 | Homo Sapiens , Mus Musculus , Synthetic Construct | DMRPEIRIAQELRRXGDEFNATYARR |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-05-23 Deposition Author(s): Brouwer, J.M. , Colman, P.M. , Cowan, A.D. , Czabotar, P.E.