Crystal structure of a hypothetical protein from neisseria gonorrhoeae with bound ppgpp
PDB DOI: 10.2210/pdb5vog/pdb
Classification: TRANSFERASE Organism(s): Neisseria Gonorrhoeae
Deposited: 2017-05-02 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Crystal structure of a hypothetical protein from neisseria gonorrhoeae with bound ppgpp
Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Primary Citation of Related Structures: 5VOG
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Putative phosphoribosyltransferase | A | 183 | Neisseria Gonorrhoeae | MAHHHHHHMKQKIWYTYDDIHRVIKALAEKIRNAGVKYDAMIAIGGGGFIPARMLRCFLEIPIYAVTTAYYDSDNEGQVTEEVKKVQWLDPVPEVLRGKNVLVVDEVDDSRVTMEFCLKELLKEDFDTVGVAVLHEKIKAKAGKIPEGIPYFSGITVEDWWINYPWDALDIDEHNRLAEAGRG |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-05-02 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease (Ssgcid)