Kaiso (zbtb33) zinc finger dna binding domain in complex with a hemi cpg-methylated dna resembling the specific kaiso binding sequence (kbs)
PDB DOI: 10.2210/pdb5vmy/pdb
Classification: Transcription/DNA Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2017-04-28 Deposition Author(s): Dyson, H.J. , Martinez-Yamout, M.A. , Nikolova, E.N. , Stanfield, R.L. , Wright, P.E.
Kaiso (zbtb33) zinc finger dna binding domain in complex with a hemi cpg-methylated dna resembling the specific kaiso binding sequence (kbs)
Dyson, H.J. , Martinez-Yamout, M.A. , Nikolova, E.N. , Stanfield, R.L. , Wright, P.E.
Primary Citation of Related Structures: 5VMY
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transcriptional regulator Kaiso | A | 134 | Homo Sapiens , Synthetic Construct | MANKRMKVKHDDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKHEIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYLSDRS |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-04-28 Deposition Author(s): Dyson, H.J. , Martinez-Yamout, M.A. , Nikolova, E.N. , Stanfield, R.L. , Wright, P.E.