Zinc finger of human cxxc4 in complex with cpg dna
PDB DOI: 10.2210/pdb5vc9/pdb
Classification: DNA BINDING PROTEIN Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2017-03-31 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Liu, K. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W. , Walker, J.R. , Xu, C.
Zinc finger of human cxxc4 in complex with cpg dna
Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Liu, K. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W. , Walker, J.R. , Xu, C.
Primary Citation of Related Structures: 5VC9
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| CXXC-type zinc finger protein 4 | C | 49 | Homo Sapiens , Synthetic Construct | GKKKRKRCGVCVPCKRLINCGVCSSCRNRKTGHQICKFRKCEELKKKPG |
| CXXC-type zinc finger protein 4 | F | 49 | Homo Sapiens , Synthetic Construct | GKKKRKRCGVCVPCKRLINCGVCSSCRNRKTGHQICKFRKCEELKKKPG |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-03-31 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Liu, K. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W. , Walker, J.R. , Xu, C.