Crystal structure of schizosaccharomyces pombe pot1pc bound to ssrna/ssdna chimera (ggttacrgrgru)
PDB DOI: 10.2210/pdb5uso/pdb
Classification: DNA BINDING PROTEIN/DNA/RNA Organism(s): Conus Stercusmuscarum , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2017-02-13 Deposition Author(s): Lloyd, N.R. , Wuttke, D.S.
Method: X-RAY DIFFRACTION Resolution: 2 Å
Crystal structure of schizosaccharomyces pombe pot1pc bound to ssrna/ssdna chimera (ggttacrgrgru)
Primary Citation of Related Structures: 5USO
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Protection of telomeres protein 1 | A | 139 | Conus Stercusmuscarum , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | DSFSLLSQITPHQRCSFYAQVIKTWYSDKNFTLYVTDYTENELFFPMSPYTSSSRWRGPFGRFSIRCILWDEHDFYCRNYIKEGDYVVMKNVRTKIDHLGYLECILHGDSAKRYNMSIEKVDSEEPELNEIKSRKRLYV |
Nucleic Acids / Hybrid | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
7-9R_9mer DNA/RNA (5'-D(*GP*GP*TP*TP*AP*C)-R(P*GP*GP*U)-3') | b | 9 | NA | GGTTACGGU |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-02-13 Deposition Author(s): Lloyd, N.R. , Wuttke, D.S.