Structure of cofolded flifc:flign complex from thermotoga maritima
PDB DOI: 10.2210/pdb5tdy/pdb
Classification: MOTOR PROTEIN Organism(s): Thermotoga Maritima , Thermotoga Maritima (Strain Atcc 43589 / Msb8 / Dsm 3109 / Jcm 10099)
Deposited: 2016-09-20 Deposition Author(s): Blair, D.F. , Crane, B.R. , Dahlquist, F.W. , Kim, E.A. , Levenson, R. , Lynch, M.J. , Sircar, R.
Method: X-RAY DIFFRACTION Resolution: 2.105 Å
Structure of cofolded flifc:flign complex from thermotoga maritima
Blair, D.F. , Crane, B.R. , Dahlquist, F.W. , Kim, E.A. , Levenson, R. , Lynch, M.J. , Sircar, R.
Primary Citation of Related Structures: 5TDY
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Flagellar M-ring protein | A | 43 | Thermotoga Maritima , Thermotoga Maritima (Strain Atcc 43589 / Msb8 / Dsm 3109 / Jcm 10099) | MPEEKELLELLEELENIFSRSPSDIAEIVRLWFFERGLENLYF |
| Flagellar M-ring protein | C | 43 | Thermotoga Maritima , Thermotoga Maritima (Strain Atcc 43589 / Msb8 / Dsm 3109 / Jcm 10099) | MPEEKELLELLEELENIFSRSPSDIAEIVRLWFFERGLENLYF |
| Flagellar motor switch protein FliG | B | 98 | Thermotoga Maritima , Thermotoga Maritima (Strain Atcc 43589 / Msb8 / Dsm 3109 / Jcm 10099) | MPEKKIDGRRKAAVLLVALGPEKAAQVMKHLDEETVEQLVVEIANIGRVTPEEKKQVLEEFLSLAKAKEMISEGGIEYAKKVLEKAFGPERARKIIER |
| Flagellar motor switch protein FliG | D | 98 | Thermotoga Maritima , Thermotoga Maritima (Strain Atcc 43589 / Msb8 / Dsm 3109 / Jcm 10099) | MPEKKIDGRRKAAVLLVALGPEKAAQVMKHLDEETVEQLVVEIANIGRVTPEEKKQVLEEFLSLAKAKEMISEGGIEYAKKVLEKAFGPERARKIIER |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-09-20 Deposition Author(s): Blair, D.F. , Crane, B.R. , Dahlquist, F.W. , Kim, E.A. , Levenson, R. , Lynch, M.J. , Sircar, R.