PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

5TDY

Structure of cofolded flifc:flign complex from thermotoga maritima

PDB DOI: 10.2210/pdb5tdy/pdb

Classification: MOTOR PROTEIN
Organism(s): Thermotoga Maritima , Thermotoga Maritima (Strain Atcc 43589 / Msb8 / Dsm 3109 / Jcm 10099)

Deposited: 2016-09-20
Deposition Author(s): Blair, D.F. , Crane, B.R. , Dahlquist, F.W. , Kim, E.A. , Levenson, R. , Lynch, M.J. , Sircar, R.

Experimental Data Snapshot

Method: X-RAY DIFFRACTION
Resolution: 2.105 Å

Literature

Structure of cofolded flifc:flign complex from thermotoga maritima

Blair, D.F. , Crane, B.R. , Dahlquist, F.W. , Kim, E.A. , Levenson, R. , Lynch, M.J. , Sircar, R.

Primary Citation of Related Structures: 5TDY


Proteins
Molecule Chains Sequence Length Organism Sequence
Flagellar M-ring protein A 43 Thermotoga Maritima , Thermotoga Maritima (Strain Atcc 43589 / Msb8 / Dsm 3109 / Jcm 10099) MPEEKELLELLEELENIFSRSPSDIAEIVRLWFFERGLENLYF
Flagellar M-ring protein C 43 Thermotoga Maritima , Thermotoga Maritima (Strain Atcc 43589 / Msb8 / Dsm 3109 / Jcm 10099) MPEEKELLELLEELENIFSRSPSDIAEIVRLWFFERGLENLYF
Flagellar motor switch protein FliG B 98 Thermotoga Maritima , Thermotoga Maritima (Strain Atcc 43589 / Msb8 / Dsm 3109 / Jcm 10099) MPEKKIDGRRKAAVLLVALGPEKAAQVMKHLDEETVEQLVVEIANIGRVTPEEKKQVLEEFLSLAKAKEMISEGGIEYAKKVLEKAFGPERARKIIER
Flagellar motor switch protein FliG D 98 Thermotoga Maritima , Thermotoga Maritima (Strain Atcc 43589 / Msb8 / Dsm 3109 / Jcm 10099) MPEKKIDGRRKAAVLLVALGPEKAAQVMKHLDEETVEQLVVEIANIGRVTPEEKKQVLEEFLSLAKAKEMISEGGIEYAKKVLEKAFGPERARKIIER
Experimental Data

Method: X-RAY DIFFRACTION

Deposited Date: 2016-09-20
Deposition Author(s): Blair, D.F. , Crane, B.R. , Dahlquist, F.W. , Kim, E.A. , Levenson, R. , Lynch, M.J. , Sircar, R.