Solution nmr structure of phf20 phd domain in complex with a histone h3k4me2 peptide
PDB DOI: 10.2210/pdb5tbn/pdb
Classification: TRANSCRIPTION / STRUCTURAL PROTEIN Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2016-09-12 Deposition Author(s): Botuyan, M.V. , Cui, G. , Mer, G.
Method: SOLUTION NMR Resolution: N.A.
Solution nmr structure of phf20 phd domain in complex with a histone h3k4me2 peptide
Botuyan, M.V. , Cui, G. , Mer, G.
Primary Citation of Related Structures: 5TBN
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PHD finger protein 20 | A | 57 | Homo Sapiens , Synthetic Construct | GHMDRYDFEVVRCICEVQEENDFMIQCEECQCWQHGVCMGLLEENVPEKYTCYVCQD |
| Histone H3.1 | C | 12 | Homo Sapiens , Synthetic Construct | ARTKQTARKSTX |
Method: SOLUTION NMR
Deposited Date: 2016-09-12 Deposition Author(s): Botuyan, M.V. , Cui, G. , Mer, G.