5TBN
Solution nmr structure of phf20 phd domain in complex with a histone h3k4me2 peptide
PDB DOI: 10.2210/pdb5tbn/pdb
Classification: TRANSCRIPTION / STRUCTURAL PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2016-09-12 Deposition Author(s): Botuyan, M.V. , Cui, G. , Mer, G.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution nmr structure of phf20 phd domain in complex with a histone h3k4me2 peptide
Botuyan, M.V. , Cui, G. , Mer, G.
Primary Citation of Related Structures: 5TBN
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PHD finger protein 20 | A | 57 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GHMDRYDFEVVRCICEVQEENDFMIQCEECQCWQHGVCMGLLEENVPEKYTCYVCQD |
| Histone H3.1 | C | 12 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ARTKQTARKSTX |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2016-09-12 Deposition Author(s): Botuyan, M.V. , Cui, G. , Mer, G.