Crystal structure of a peptide deformylase from burkholderia multivorans in complex with actinonin
PDB DOI: 10.2210/pdb5t8z/pdb
Classification: hydrolase/antibiotic Organism(s): Burkholderia Multivorans (Strain Atcc 17616 / 249)
Deposited: 2016-09-08 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Crystal structure of a peptide deformylase from burkholderia multivorans in complex with actinonin
Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Primary Citation of Related Structures: 5T8Z
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Peptide deformylase | A | 185 | Burkholderia Multivorans (Strain Atcc 17616 / 249) | MAHHHHHHMIREILKMGDPRLLEVARPVDRFDTPELHEIVADMFETMHHANGAGLAAPQIGIGLQIIIFGFGSNDRYPDAPPVPETVLINPKLEYMPPDMEEGWEGCLSVPGMRGVVSRYAKVRYSGFDQFGAKIDRVAEGFHARVVQHEYDHLIGKLYPMRITDFTRFGFTEVLFPGLDPAADD |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-09-08 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease (Ssgcid)