Crystal structure of human baz2a phd zinc finger in complex with unmodified h3 10-mer
PDB DOI: 10.2210/pdb5t8r/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2016-09-08 Deposition Author(s): Amato, A. , Bortoluzzi, A. , Ciulli, A. , Gadd, M.S.
Crystal structure of human baz2a phd zinc finger in complex with unmodified h3 10-mer
Amato, A. , Bortoluzzi, A. , Ciulli, A. , Gadd, M.S.
Primary Citation of Related Structures: 5T8R
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Bromodomain adjacent to zinc finger domain protein 2A | A | 58 | Homo Sapiens , Synthetic Construct | HMSVNKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQV |
Bromodomain adjacent to zinc finger domain protein 2A | B | 58 | Homo Sapiens , Synthetic Construct | HMSVNKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQV |
Bromodomain adjacent to zinc finger domain protein 2A | C | 58 | Homo Sapiens , Synthetic Construct | HMSVNKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQV |
Bromodomain adjacent to zinc finger domain protein 2A | D | 58 | Homo Sapiens , Synthetic Construct | HMSVNKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQV |
Histone H3.1 | E | 10 | Homo Sapiens , Synthetic Construct | ARTKQTARKS |
Histone H3.1 | G | 10 | Homo Sapiens , Synthetic Construct | ARTKQTARKS |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-09-08 Deposition Author(s): Amato, A. , Bortoluzzi, A. , Ciulli, A. , Gadd, M.S.