Structure of the ebola virus envelope protein mper/tm domain and its interaction with the fusion loop explains their fusion activity
PDB DOI: 10.2210/pdb5t42/pdb
Classification: VIRAL PROTEIN Organism(s): Zaire Ebolavirus (Strain Kikwit-95)
Deposited: 2016-08-28 Deposition Author(s): Cafiso, D.S. , Lee, J. , Nelson, E.A. , Nyenhuis, D.A. , Tamm, L.K. , White, J.M.
Method: SOLUTION NMR Resolution: N.A.
Structure of the ebola virus envelope protein mper/tm domain and its interaction with the fusion loop explains their fusion activity
Cafiso, D.S. , Lee, J. , Nelson, E.A. , Nyenhuis, D.A. , Tamm, L.K. , White, J.M.
Primary Citation of Related Structures: 5T42
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Envelope glycoprotein | A | 47 | Zaire Ebolavirus (Strain Kikwit-95) | GSDKTLPDQGDNDNWWTGWRQWIPAGIGVTGVVIAVIALFAIAKFVF |
Method: SOLUTION NMR
Deposited Date: 2016-08-28 Deposition Author(s): Cafiso, D.S. , Lee, J. , Nelson, E.A. , Nyenhuis, D.A. , Tamm, L.K. , White, J.M.