Structure of the ebola virus envelope protein mper/tm domain and its interaction with the fusion loop explains their fusion activity
PDB DOI: 10.2210/pdb5t42/pdb
Classification: VIRAL PROTEIN Organism(s): Kitasatospora Cystarginea
Deposited: 2016-08-28 Deposition Author(s): Cafiso, D.S. , Lee, J. , Nelson, E.A. , Nyenhuis, D.A. , Tamm, L.K. , White, J.M.
Structure of the ebola virus envelope protein mper/tm domain and its interaction with the fusion loop explains their fusion activity
Cafiso, D.S. , Lee, J. , Nelson, E.A. , Nyenhuis, D.A. , Tamm, L.K. , White, J.M.
Primary Citation of Related Structures: 5T42
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Envelope glycoprotein | A | 47 | Kitasatospora Cystarginea | GSDKTLPDQGDNDNWWTGWRQWIPAGIGVTGVVIAVIALFAIAKFVF |
Method: SOLUTION NMR
Deposited Date: 2016-08-28 Deposition Author(s): Cafiso, D.S. , Lee, J. , Nelson, E.A. , Nyenhuis, D.A. , Tamm, L.K. , White, J.M.