Crystal structure of multi-drug resistant hiv-1 protease pr-s17 in complex with darunavir
PDB DOI: 10.2210/pdb5t2z/pdb
Classification: Hydrolase/Hydrolase inhibitor Organism(s): Human Immunodeficiency Virus 1
Deposited: 2016-08-24 Deposition Author(s): Agniswamy, J. , Weber, I.T.
Crystal structure of multi-drug resistant hiv-1 protease pr-s17 in complex with darunavir
Primary Citation of Related Structures: 5T2Z
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protease | A | 99 | Human Immunodeficiency Virus 1 | PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDIDLPGRWKPKLIVGIGGFVKVRQYEQVPIEIAGHKVVGTVLIGPTPSNIIGRNLMTQLGATLNF |
| Protease | B | 99 | Human Immunodeficiency Virus 1 | PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDIDLPGRWKPKLIVGIGGFVKVRQYEQVPIEIAGHKVVGTVLIGPTPSNIIGRNLMTQLGATLNF |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-08-24 Deposition Author(s): Agniswamy, J. , Weber, I.T.