The solution nmr structure for the pqqd truncation of methylobacterium extorquens pqqcd representing a functional and stand-alone ribosomally synthesized and post-translational modified (ripp) recognition element (rre)
PDB DOI: 10.2210/pdb5sxy/pdb
Classification: CHAPERONE Organism(s): Methylobacterium Extorquens (Strain Atcc 14718 / Dsm 1338 / Am1)
Deposited: 2016-08-10 Deposition Author(s): Evans, R.L. , Wilmot, C.M. , Xia, Y.
Method: SOLUTION NMR Resolution: N.A.
The solution nmr structure for the pqqd truncation of methylobacterium extorquens pqqcd representing a functional and stand-alone ribosomally synthesized and post-translational modified (ripp) recognition element (rre)
Evans, R.L. , Wilmot, C.M. , Xia, Y.
Primary Citation of Related Structures: 5SXY
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Bifunctional coenzyme PQQ synthesis protein C/D | A | 94 | Methylobacterium Extorquens (Strain Atcc 14718 / Dsm 1338 / Am1) | MEPTAFSGSDVPRLPRGVRLRFDEVRNKHVLLAPERTFDLDDNAVAVLKLVDGRNTVSQIAQILGQTYDADPAIIEADILPMLAGLAQKRVLER |
Method: SOLUTION NMR
Deposited Date: 2016-08-10 Deposition Author(s): Evans, R.L. , Wilmot, C.M. , Xia, Y.