Pandda analysis group deposition -- crystal structure of atad2 in complex with df852
PDB DOI: 10.2210/pdb5qxs/pdb
Classification: HYDROLASE/HYDROLASE INHIBITOR Organism(s): Homo Sapiens
Deposited: 2020-03-09 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Collins, P. , Edwards, A. , Fowley, D. , Nelson, A. , Snee, M. , Talon, R. , Von-Delft, F.
Pandda analysis group deposition -- crystal structure of atad2 in complex with df852
Arrowsmith, C.H. , Bountra, C. , Collins, P. , Edwards, A. , Fowley, D. , Nelson, A. , Snee, M. , Talon, R. , Von-Delft, F.
Primary Citation of Related Structures: 5QXS
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| ATPase family AAA domain-containing protein 2 | A | 130 | Homo Sapiens | SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYRTVIKEPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-03-09 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Collins, P. , Edwards, A. , Fowley, D. , Nelson, A. , Snee, M. , Talon, R. , Von-Delft, F.