Pandda analysis group deposition of models with modelled events (e.g. bound ligands) -- crystal structure of human parp14 macrodomain 3 in complex with fmopl000633a
PDB DOI: 10.2210/pdb5qi5/pdb
Classification: TRANSFERASE Organism(s): Homo Sapiens
Deposited: 2018-05-21 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Brandao-Neto, J. , Douangamath, A. , Edwards, A. , Elkins, J. , Kessler, B. , Knapp, S. , Krojer, T. , Schuler, H. , Schuller, M. , Talon, R. , Von Delft, F. , Zhang, R.
Pandda analysis group deposition of models with modelled events (e.g. bound ligands) -- crystal structure of human parp14 macrodomain 3 in complex with fmopl000633a
Arrowsmith, C.H. , Bountra, C. , Brandao-Neto, J. , Douangamath, A. , Edwards, A. , Elkins, J. , Kessler, B. , Knapp, S. , Krojer, T. , Schuler, H. , Schuller, M. , Talon, R. , Von Delft, F. , Zhang, R.
Primary Citation of Related Structures: 5QI5
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Poly [ADP-ribose] polymerase 14 | A | 183 | Homo Sapiens | SMFYGTVSSPDSGVYEMKIGSIIFQVASGDITKEEADVIVNSTSNSFNLKAGVSKAILECAGQNVERECSQQAQQRKNDYIITGGGFLRCKNIIHVIGGNDVKSSVSSVLQECEKKNYSSICLPAIGTGNAKQHPDKVAEAIIDAIEDFVQKGSAQSVKKVKVVIFLPQVLDVFYANMKKREG |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-05-21 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Brandao-Neto, J. , Douangamath, A. , Edwards, A. , Elkins, J. , Kessler, B. , Knapp, S. , Krojer, T. , Schuler, H. , Schuller, M. , Talon, R. , Von Delft, F. , Zhang, R.