Pandda analysis group deposition of models with modelled events (e.g. bound ligands) -- crystal structure of nudt7 in complex with fmopl000022a
PDB DOI: 10.2210/pdb5qgr/pdb
Classification: HYDROLASE Organism(s): Homo Sapiens
Deposited: 2018-05-15 Deposition Author(s): Aimon, A. , Arrowsmith, C.H. , Bountra, C. , Bradley, A.R. , Brandao-Neto, J. , Brennan, P.E. , Collins, P. , Diaz Saez, L. , Douangamath, A. , Edwards, A. , Elkins, J. , Fairhead, M. , Huber, K. , Krojer, T. , London, N. , Nelson, A. , Ruda, G.F. , Spencer, J. , Srikannathasan, V. , Szommer, T. , Talon, R. , Von Delft, F.
Pandda analysis group deposition of models with modelled events (e.g. bound ligands) -- crystal structure of nudt7 in complex with fmopl000022a
Aimon, A. , Arrowsmith, C.H. , Bountra, C. , Bradley, A.R. , Brandao-Neto, J. , Brennan, P.E. , Collins, P. , Diaz Saez, L. , Douangamath, A. , Edwards, A. , Elkins, J. , Fairhead, M. , Huber, K. , Krojer, T. , London, N. , Nelson, A. , Ruda, G.F. , Spencer, J. , Srikannathasan, V. , Szommer, T. , Talon, R. , Von Delft, F.
Primary Citation of Related Structures: 5QGR
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Peroxisomal coenzyme A diphosphatase NUDT7 | A | 196 | Homo Sapiens | SMLDDAKARLRKYDIGGKYSHLPYNKYSVLLPLVAKEGKLHLLFTVRSEKLRRAPGEVCFPGGKRDPTDMDDAATALREAQEEVGLRPHQVEVVCCLVPCLIDTDTLITPFVGLIDHNFQAQPNPAEVKDVFLVPLAYFLHPQVHDQHYVTRLGHRFINHIFEYTNPEDGVTYQIKGMTANLAVLVAFIILEKKPT |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-05-15 Deposition Author(s): Aimon, A. , Arrowsmith, C.H. , Bountra, C. , Bradley, A.R. , Brandao-Neto, J. , Brennan, P.E. , Collins, P. , Diaz Saez, L. , Douangamath, A. , Edwards, A. , Elkins, J. , Fairhead, M. , Huber, K. , Krojer, T. , London, N. , Nelson, A. , Ruda, G.F. , Spencer, J. , Srikannathasan, V. , Szommer, T. , Talon, R. , Von Delft, F.