Pandda analysis group deposition -- crystal structure of brd1 after initial refinement with no ligand modelled (structure 230)
PDB DOI: 10.2210/pdb5pvg/pdb
Classification: GENE REGULATION Organism(s): Homo Sapiens
Deposited: 2017-02-07 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Bradley, A.R. , Brandao-Neto, J. , Brennan, P.E. , Collins, P. , Cox, O. , Dias, A. , Douangamath, A. , Edwards, A. , Fairhead, M. , Krojer, T. , Maclean, E. , Ng, J. , Pearce, N.M. , Renjie, Z. , Sethi, R. , Talon, R. , Von Delft, F. , Wright, N.
Pandda analysis group deposition -- crystal structure of brd1 after initial refinement with no ligand modelled (structure 230)
Arrowsmith, C.H. , Bountra, C. , Bradley, A.R. , Brandao-Neto, J. , Brennan, P.E. , Collins, P. , Cox, O. , Dias, A. , Douangamath, A. , Edwards, A. , Fairhead, M. , Krojer, T. , Maclean, E. , Ng, J. , Pearce, N.M. , Renjie, Z. , Sethi, R. , Talon, R. , Von Delft, F. , Wright, N.
Primary Citation of Related Structures: 5PVG
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Bromodomain-containing protein 1 | A | 156 | Homo Sapiens | MHHHHHHSSGVDLGTENLYFQSMEQVAMELRLTELTRLLRSVLDQLQDKDPARIFAQPVSLKEVPDYLDHIKHPMDFATMRKRLEAQGYKNLHEFEEDFDLIIDNCMKYNARDTVFYRAAVRLRDQGGVVLRQARREVDSIGLEEASGMHLPERPA |
| Bromodomain-containing protein 1 | B | 156 | Homo Sapiens | MHHHHHHSSGVDLGTENLYFQSMEQVAMELRLTELTRLLRSVLDQLQDKDPARIFAQPVSLKEVPDYLDHIKHPMDFATMRKRLEAQGYKNLHEFEEDFDLIIDNCMKYNARDTVFYRAAVRLRDQGGVVLRQARREVDSIGLEEASGMHLPERPA |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-02-07 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Bradley, A.R. , Brandao-Neto, J. , Brennan, P.E. , Collins, P. , Cox, O. , Dias, A. , Douangamath, A. , Edwards, A. , Fairhead, M. , Krojer, T. , Maclean, E. , Ng, J. , Pearce, N.M. , Renjie, Z. , Sethi, R. , Talon, R. , Von Delft, F. , Wright, N.