Crystal structure of s. cerevisiae ddc2 n-terminal coiled-coil domain
PDB DOI: 10.2210/pdb5omd/pdb
Classification: PROTEIN BINDING Organism(s): Saccharomyces Cerevisiae (Strain Atcc 204508 / S288C)
Deposited: 2017-07-28 Deposition Author(s): Deshpande, I. , Gasser, S.M. , Gut, H. , Keusch, J.J. , Seeber, A. , Shimada, K.
Crystal structure of s. cerevisiae ddc2 n-terminal coiled-coil domain
Deshpande, I. , Gasser, S.M. , Gut, H. , Keusch, J.J. , Seeber, A. , Shimada, K.
Primary Citation of Related Structures: 5OMD
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| DNA damage checkpoint protein LCD1 | A | 66 | Saccharomyces Cerevisiae (Strain Atcc 204508 / S288C) | GPGEASMLRDKINFLNIEREKEKNIQAVKVNELQVKHLQELAKLKQELQKLEDEKKFLQMEARGKS |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-07-28 Deposition Author(s): Deshpande, I. , Gasser, S.M. , Gut, H. , Keusch, J.J. , Seeber, A. , Shimada, K.